Antibodies

View as table Download

Rabbit polyclonal antibody to TMLHE (trimethyllysine hydroxylase, epsilon)

Applications WB
Reactivities Human (Predicted: Mouse, Chicken, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 115 and 397 of TMLHE (Uniprot ID#Q9NVH6)

Rabbit Polyclonal Anti-TMLHE Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Tmlhe antibody is: synthetic peptide directed towards the C-terminal region of Rat Tmlhe. Synthetic peptide located within the following region: ELWVKLKPGKVLFIDNWRVLHGRESFTGYRQLCGCYLTRDDVLNTARILG