Germany
Japan
United Kingdom
China
Rabbit anti-BBOX1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BBOX1 |
Antibodies
View as table Download
Rabbit anti-SUV39H2 Polyclonal Antibody
| Applications | ChIP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SUV39H2 |
Rabbit anti-SETDB1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SETDB1 |
Rabbit polyclonal antibody to TMLHE (trimethyllysine hydroxylase, epsilon)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Chicken, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 115 and 397 of TMLHE (Uniprot ID#Q9NVH6) |
Rabbit anti-ACAT2 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Rat, Sheep, Pig, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ACAT 2 |
Rabbit anti-ACAT1 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Porcine, Rat, Murine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ACAT1. |
Rabbit Polyclonal Anti-Gcdh Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Gcdh Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LQLGRLKDQDKATPEMVSLLKRNNCGKALDIARQARDILGGNGISDEYHV |
Rabbit anti-WHSC1L1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human WHSC1L1 |
Rabbit Polyclonal Anti-Wipf1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Wipf1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Wipf1. Synthetic peptide located within the following region: MPVPPPPAPPPPPTFALANTEKPSLNKTEQAGRNALLSDISKGKKLKKTV |
Rabbit Polyclonal Anti-TMLHE Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Tmlhe antibody is: synthetic peptide directed towards the C-terminal region of Rat Tmlhe. Synthetic peptide located within the following region: ELWVKLKPGKVLFIDNWRVLHGRESFTGYRQLCGCYLTRDDVLNTARILG |
Active filters
Category
- Antibodies
Reactivities
- Rat
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Pathways
- Lysine degradation