Antibodies

Jump to Filters
Download
Matriptase 2 (TMPRSS6) Rabbit Polyclonal Antibody
TA337827

USD 539.00

In Stock

Rabbit Polyclonal Anti-TMPRSS6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK
CRLR (CALCRL) Rabbit Polyclonal Antibody
TA351107

USD 380.00

In Stock

Rabbit Polyclonal Anti-CALCRL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CALCRL
IL17B Receptor (IL17RB) Rabbit Polyclonal Antibody
TA351284

USD 380.00

In Stock

Rabbit Polyclonal Anti-IL17RB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL17RB
Integrin beta 7 (ITGB7) Rabbit Polyclonal Antibody
TA351299

USD 380.00

In Stock

Rabbit Polyclonal Anti-ITGB7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ITGB7
ST2 (IL1RL1) Rabbit Polyclonal Antibody
TA321605

USD 380.00

In Stock

Anti-IL1RL1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human interleukin 1 receptor-like 1
Somatostatin Receptor 3 (SSTR3) Rabbit Polyclonal Antibody
TA323276

USD 380.00

In Stock

Anti-SSTR3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 405-418 amino acids of human somatostatin receptor 3
Her2 (ERBB2) Rabbit Polyclonal Antibody
TA324959

USD 580.00

In Stock

Rabbit polyclonal ERBB2 Antibody

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ErbB2 antibody is generated from rabbits immunized with human recombinant ErbB2 protein.
CD147 (BSG) Rabbit Polyclonal Antibody
TA590317

USD 482.00

In Stock

Rabbit Polyclonal CD147 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Rat, Monkey
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
CD30 (TNFRSF8) Rabbit Polyclonal Antibody
TA590389

USD 482.00

In Stock

Rabbit Polyclonal CD30 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
Apolipoprotein B (APOB) Rabbit Polyclonal Antibody
TA323677

USD 380.00

In Stock

Anti-APOB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2158-2177 amino acids of human apolipoprotein B (including Ag(x) antigen)
GM CSF Receptor alpha (CSF2RA) Rabbit Polyclonal Antibody
TA323990

USD 380.00

In Stock

Anti-CSF2RA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 386-400 amino acids of Human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage)
Cytochrome P450 3A4 (CYP3A4) Rabbit Polyclonal Antibody
TA324142

USD 380.00

In Stock

Anti-CYP3A4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 286 amino acids of human cytochrome P450, family 3, subfamily A, polypeptide 4
CD38 Rabbit Polyclonal Antibody
TA351051

USD 380.00

In Stock

Rabbit Polyclonal Anti-CD38 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CD38
CD10 (MME) Rabbit Polyclonal Antibody
TA590055

USD 482.00

In Stock

Rabbit Polyclonal CD10 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
PTP1B (PTPN1) Rabbit Polyclonal Antibody
TA590672

USD 482.00

In Stock

Rabbit Polyclonal PTPN1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. In vivo generated recombinant protein fragment