Germany
Japan
United Kingdom
China
Antibodies
View as table Download
MBD3 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide corresponding to amino acid residues surrounding E279 of human MBD3. |
Rabbit polyclonal anti-MBD3 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MBD3. |
MBD3 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MBD3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD3 antibody: synthetic peptide directed towards the N terminal of human MBD3. Synthetic peptide located within the following region: SKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSN |
Rabbit Polyclonal Anti-Mbd3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mbd3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLA |
Rabbit Polyclonal Anti-MBD3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD3 Antibody: A synthesized peptide derived from human MBD3 |
MBD3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-255 of human MBD3 (NP_001268383.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MBD3
Applications
- WB
Antibody Hosts
- Rabbit