Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal MBD2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This MBD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 250-279 amino acids from the Central region of human MBD2. |
Rabbit Polyclonal MBD2 Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD2 antibody: mouse MBD2 (methyl-CpG binding domain protein 2), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the central part of the protein |
MBD2 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human MBD2 |
MBD2 rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from internal domain of MBD2 human protein |
Rabbit Polyclonal Anti-MBD2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD2 antibody: synthetic peptide directed towards the N terminal of human MBD2. Synthetic peptide located within the following region: RAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRR |
Rabbit Polyclonal Anti-MBD2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD2 antibody: synthetic peptide directed towards the middle region of human MBD2. Synthetic peptide located within the following region: DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT |
MBD2 (N-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human MBD2. |
MBD2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MBD2 |
MBD2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 202-411 of human MBD2 (NP_003918.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MBD2
Applications
- WB
Antibody Hosts
- Rabbit