Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-IDH3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IDH3B antibody is: synthetic peptide directed towards the N-terminal region of Human IDH3B. Synthetic peptide located within the following region: SEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRK |
Rabbit Polyclonal Anti-IDH3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IDH3B antibody is: synthetic peptide directed towards the N-terminal region of Human IDH3B. Synthetic peptide located within the following region: RIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKF |
Rabbit Polyclonal Anti-IDH3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IDH3B antibody is: synthetic peptide directed towards the C-terminal region of Human IDH3B. Synthetic peptide located within the following region: YMTRHNNLDLVIIREQTEGEYSSLEHEVRPQKLGEGKDEDGREVELLVSL |
IDH3B Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IDH3B |
Active filters
Target Symbol
- IDH3B
Applications
- WB
Antibody Hosts
- Rabbit