Rabbit Polyclonal antibody to CHMP5 (chromatin modifying protein 5)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Pig, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 202 of CHMP5 (Uniprot ID#Q9NZZ3) |
Rabbit Polyclonal Anti-Chmp5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Chmp5 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Chmp5. Synthetic peptide located within the following region: LDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQI |
CHMP5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human CHMP5 |
Germany
Japan
United Kingdom
China
