SLIT1 (487-504) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Chicken, Frog, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic Peptide corresponding to aa 487-504 of Mouse SLIT-1 protein |
SLIT1 (487-504) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Chicken, Frog, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic Peptide corresponding to aa 487-504 of Mouse SLIT-1 protein |
Rabbit Polyclonal Anti-SLIT1 Antibody - middle region
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLIT1 antibody: synthetic peptide directed towards the middle region of human SLIT1. Synthetic peptide located within the following region: GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC |
Rabbit polyclonal anti-SLIT-1 antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding aa 487-504 of mouse SLIT-1 protein. |
SLIT1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1315-1534 of human SLIT1 (NP_003052.2). |
Modifications | Unmodified |