Antibodies

Jump to Filters
View as table Download
BMP6 Rabbit Polyclonal Antibody
AP20577PU-N

USD 445.00

3 Weeks

BMP6 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 125-170 of Human BMP-6.
BMP6 Rabbit Polyclonal Antibody
TA351009

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-BMP6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human BMP6
BMP6 Rabbit Polyclonal Antibody
TA344216

USD 539.00

5 Days

Rabbit Polyclonal Anti-BMP6 Antibody - middle region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the middle region of human BMP6. Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL
BMP6 Rabbit Polyclonal Antibody
TA374036

USD 365.00

3 Weeks

BMP6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human BMP6 (NP_001709.1).
Modifications Unmodified