Germany
Japan
United Kingdom
China
Antibodies
View as table Download
PSCA Rabbit monoclonal antibody,clone OTIR2A2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal Prostate Stem Cell Antigen antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Prostate Stem Cell Antigen antibody. |
PSCA rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 41-90 of Human PSCA. |
PSCA (Center) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 56-85 amino acids from the Central region of human PSCA. |
Rabbit Polyclonal Anti-PSCA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSCA antibody: synthetic peptide directed towards the C terminal of human PSCA. Synthetic peptide located within the following region: TVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILAL |
PSCA Rabbit monoclonal antibody,clone OTIR2A2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- PSCA
Reactivities
- Human
Applications
- WB
Antibody Hosts
- Rabbit