Antibodies

Jump to Filters
View as table Download
ABCB7 Rabbit Polyclonal Antibody
TA313408

USD 380.00

4 Weeks

Rabbit polyclonal anti-ABCB7 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCB7.
ABCB7 Rabbit Polyclonal Antibody
TA373132

USD 365.00

3 Weeks

ABCB7 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 503-753 of human ABCB7 (NP_004290.2).
Modifications Unmodified
ABCB7 (C-term) Rabbit Polyclonal Antibody
AP13077PU-N

USD 580.00

2 Weeks

ABCB7 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human ABCB7.
ABCB7 Rabbit Polyclonal Antibody
TA332141

USD 539.00

5 Days

Rabbit Polyclonal Anti-ABCB7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCB7 Antibody is: synthetic peptide directed towards the C-terminal region of Human ABCB7. Synthetic peptide located within the following region: DEATSSLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQG
ABCB7 Rabbit Polyclonal Antibody
TA359357

USD 539.00

5 Days

ABCB7 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human ABCB7