DFFB (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 1~30 amino acids from the N-terminal region of Human DFFB / CAD. |
DFFB (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 1~30 amino acids from the N-terminal region of Human DFFB / CAD. |
Rabbit Polyclonal Anti-DFFB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DFFB antibody: synthetic peptide directed towards the middle region of human DFFB. Synthetic peptide located within the following region: EYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRK |