Antibodies

View as table Download

Rabbit Polyclonal Anti-DCLRE1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCLRE1C antibody: synthetic peptide directed towards the N terminal of human DCLRE1C. Synthetic peptide located within the following region: SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRL

Rabbit Polyclonal Anti-DCLRE1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCLRE1C antibody: synthetic peptide directed towards the C terminal of human DCLRE1C. Synthetic peptide located within the following region: SQSPKLFSDSDGESTHISSQNSSQSTHITEQGSQGWDSQSDTVLLSSQER