Antibodies

Jump to Filters
View as table Download
KCNK5 Rabbit Polyclonal Antibody
TA328676

USD 850.00

3 Weeks

Rabbit Polyclonal Anti-K2P5.1 (TASK-2)

Applications IHC, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide (C)YEQLMNEYNKANSPKGT, amino acid residues 483-499 of human K2P5.1 . Intracellular, C-terminus.
KCNK5 Rabbit Polyclonal Antibody
TA331458

USD 539.00

5 Days

Rabbit polyclonal Anti-KCNK5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNK5 antibody: synthetic peptide directed towards the C terminal of human KCNK5. Synthetic peptide located within the following region: TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSES
KCNK5 Rabbit Polyclonal Antibody
TA338537

USD 539.00

5 Days

Rabbit Polyclonal Anti-Kcnk5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Kcnk5 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AWLSLFVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKALQMAGSTAS
KCNK5 Rabbit Polyclonal Antibody
TA360262

USD 539.00

5 Days

KCNK5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KCNK5