Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal CD28 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | This CD28 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-208 amino acids from the C-terminal region of human CD28. |
Rabbit anti-CD3E Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD3E |
Rabbit Polyclonal Anti-CD40LG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Rabbit Polyclonal CD45 (Ser1007) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD45 around the phosphorylation site of Serine 1007 |
| Modifications | Phospho-specific |
Rabbit polyclonal LAT (Ab-255) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human LAT around the phosphorylation site of tyrosine 255. |
Rabbit anti-PTPRC Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Mouse, Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human PTPRC |
Active filters
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Transmembrane
Pathways
- T cell receptor signaling pathway