Antibodies

View as table Download

Rabbit Polyclonal ING1 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal Anti-ING1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ING1 antibody: synthetic peptide directed towards the N terminal of human ING1. Synthetic peptide located within the following region: SPAERLVAEADEGGPSAITGMGLCFRCLLFSFSGRSGVEGGRVDLNVFGS

Rabbit Polyclonal Anti-ING1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ING1 antibody: synthetic peptide directed towards the C terminal of human ING1. Synthetic peptide located within the following region: EKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCD

Rabbit Polyclonal Anti-ING1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ING1