Rabbit polyclonal RELA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA. |
Rabbit polyclonal RELA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA. |
Rabbit polyclonal RELA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA. |
RELA Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide (the amino acid sequence is considered to be commercially sensitive) within Human RELA (NP_068810). The exact sequence is proprietary. |
Rabbit Polyclonal anti-TP53 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal c-jun Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
Applications | IHC, WB |
Reactivities | Human, Mouse (Predicted: Chicken, Rabbit, Rat, Xenopus, Bovine, X. tropicalis) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit polyclonal anti-TGF Beta1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β1 antibody. |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
Modifications | Phospho-specific |
Rabbit Polyclonal c-Fos Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
Applications | FC, IF, WB |
Reactivities | Human, Mouse (Predicted: Rat, Dog, Feline, Pig, Sheep, Chimpanzee, Bovine, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
Rabbit anti-TP53 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TP53 |
Rabbit Polyclonal Anti-PPP5C Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PPP5C |
Rabbit polyclonal antibody to IKK beta (inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 493 and 739 of IKK beta (Uniprot ID#O14920) |
Rabbit Polyclonal antibody to NLK (nemo-like kinase)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 234 and 527 of NLK (Uniprot ID#Q9UBE8) |