Antibodies

Jump to Filters
View as table Download
IL1RAP Rabbit Polyclonal Antibody
TA324046

USD 380.00

2 Weeks

Anti-IL1RAP Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 22-356 amino acids of Human Interleukin-1 receptor accessory protein
IL1 alpha (IL1A) Rabbit Polyclonal Antibody
TA349352

USD 380.00

In Stock

Rabbit Polyclonal Anti-IL1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IL1A
TNFRSF1A Rabbit Polyclonal Antibody
TA328458

USD 314.00

In Stock

Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human sTNF Receptor Type I
Fas Ligand (FASLG) Rabbit Polyclonal Antibody
TA313465

USD 380.00

In Stock

Rabbit polyclonal FAS ligand antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FAS ligand.
NGF Rabbit Polyclonal Antibody
TA321493

USD 380.00

4 Weeks

Anti-NGF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 80-94 amino acids of human nerve growth factor (beta polypeptide)
CD95 (FAS) Rabbit Polyclonal Antibody
TA323754

USD 380.00

4 Weeks

Anti-FAS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 156-335 amino acids of human Fas (TNF receptor superfamily, member 6)
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA319289

USD 1,795.00

5 Days

Rabbit polyclonal TNF Alpha antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA319290

USD 1,795.00

5 Days

Rabbit polyclonal TNF alpha antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.
CD95 (FAS) Rabbit Polyclonal Antibody
TA313381

USD 380.00

In Stock

Rabbit polyclonal anti-FAS antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Fas.
TNFRSF1A Rabbit Polyclonal Antibody
TA327070

USD 365.00

3 Weeks

Rabbit anti-TNF-R1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TNF-R1
CD95 (FAS) Rabbit Polyclonal Antibody
TA590390

USD 482.00

In Stock

Rabbit Polyclonal Fas Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
TNFRSF1A (195-211) Rabbit Polyclonal Antibody
AP23346PU-N

USD 560.00

2 Weeks

TNFRSF1A (195-211) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Goat, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequencein the middle region of Human TNFR1 (aa 195-211).
TNFRSF1A Rabbit Polyclonal Antibody
TA330321

USD 539.00

5 Days

Rabbit Polyclonal Anti-TNFRSF1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF1A antibody: synthetic peptide directed towards the N terminal of human TNFRSF1A. Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI
NGF Rabbit Polyclonal Antibody
TA347902

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-NGF beta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-NGF beta Antibody: A synthesized peptide derived from human NGF beta
IL3 Rabbit Polyclonal Antibody
TA319285

USD 765.00

In Stock

Rabbit polyclonal anti-IL-3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-3 antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-3 protein.