Antibodies

View as table Download

Rabbit polyclonal Anti-FYN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FYN antibody: synthetic peptide directed towards the N terminal of human FYN. Synthetic peptide located within the following region: GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN

Rabbit polyclonal FYN Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human (Predicted: Bovine, Pig)
Conjugation Unconjugated
Immunogen This FYN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human FYN.

Rabbit polyclonal anti-ABL1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABL1.

Rabbit polyclonal Fyn (Phospho-Tyr530) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Fyn around the phosphorylation site of tyrosine 530 (P-Q-YP-Q-P).
Modifications Phospho-specific

Rabbit polyclonal Fyn (Ab-530) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Fyn around the phosphorylation site of tyrosine 530 (P-Q-YP-Q-P).

Rabbit Polyclonal Fyn (Tyr530) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Fyn around the phosphorylation site of Tyrosine 530
Modifications Phospho-specific

Rabbit Polyclonal c-Abl Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Abl

Rabbit Polyclonal Abl (Tyr204) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Abl around the phosphorylation site of Tyrosine 204
Modifications Phospho-specific

Rabbit Polyclonal Abl (Tyr393/412) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Abl around the phosphorylation site of Tyrosine 393/412
Modifications Phospho-specific

Rabbit Polyclonal Abl (Tyr412) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Abl around the phosphorylation site of Tyrosine 412
Modifications Phospho-specific

Rabbit Polyclonal c-Abl (Tyr245) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Abl around the phosphorylation site of Tyrosine 245
Modifications Phospho-specific

Rabbit Polyclonal Fyn Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Fyn

Rabbit Polyclonal Anti-KYNU Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FYN

Rabbit Polyclonal Abl Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Abl

Rabbit Polyclonal c-Abl Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Abl