Antibodies

View as table Download

5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal 5-HT7 Antibody

Applications FC, ICC/IF, Simple Western, WB
Reactivities Human, Mouse, Rat, Canine
Conjugation Unconjugated
Immunogen This antibody was developed by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 13-28 of the rat 5-HT7R (AAA42134.1).

5HT7 Receptor (HTR7) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

5HT7 Receptor (HTR7) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 404-433 amino acids from the C-terminal region of Human Serotonin receptor 7 (HTR7).

Rabbit Polyclonal Anti-HTR7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR7 antibody: synthetic peptide directed towards the N terminal of human HTR7. Synthetic peptide located within the following region: HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTI

Rabbit Polyclonal Anti-HTR7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR7 antibody: synthetic peptide directed towards the N terminal of human HTR7. Synthetic peptide located within the following region: HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTI