Antibodies

Jump to Filters
View as table Download
TAT Rabbit Polyclonal Antibody
TA323688

USD 380.00

2 Weeks

Anti-TAT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 250 amino acids of human tyrosine aminotransferase
TAT (Center) Rabbit Polyclonal Antibody
AP54159PU-N

USD 580.00

2 Weeks

TAT (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 285~315 amino acids from the Central region of human TAT
Thyroid Peroxidase (TPO) Rabbit Polyclonal Antibody
TA335246

USD 539.00

5 Days

Rabbit Polyclonal Anti-TPO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPO antibody is: synthetic peptide directed towards the N-terminal region of Human TPO. Synthetic peptide located within the following region: GASNTALARWLPPVYEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVS
Thyroid Peroxidase (TPO) Rabbit Polyclonal Antibody
TA356382

USD 539.00

5 Days

TPO Antibody - C-terminal region (ARP44312_P050)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TPO