Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal ADH1B Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Chicken) |
| Conjugation | Unconjugated |
| Immunogen | This ADH1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-237 amino acids from the Central region of human ADH1B. |
Rabbit polyclonal ADH4 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ADH4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 319-348 amino acids from the C-terminal region of human ADH4. |
Rabbit Polyclonal Anti-CPT1B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPT1B antibody: synthetic peptide directed towards the middle region of human CPT1B. Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA |
Rabbit Polyclonal Anti-ALDH2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Aldh2 antibody is synthetic peptide directed towards the C-terminal region of Mouse Aldh2. Synthetic peptide located within the following region: QPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAV |
Active filters
Reactivities
- Mouse
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Druggable Genome
Pathways
- Fatty acid metabolism