Rabbit monoclonal anti-Sox2 Antibody, clone OTIR-2D11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR-2D11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OR-4F2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal CD4 Antibody
Applications | FC, ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Rabbit |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR-2D11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Oct4 (POU5F1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 200-250 of Human Oct-3/4. |
Rabbit Polyclonal Anti-BDNF
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor). |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Sheep |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit Polyclonal Antibody against OCT4 - Embryonic Stem Cell Marker
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human OCT4 protein sequence (between residues 100-200). |
Rabbit polyclonal KLF4 Antibody (N-term C74)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4. |
Rabbit polyclonal EGFR (Ab-1172) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
BMP6 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 125-170 of Human BMP-6. |
Rabbit Polyclonal Anti-WNT2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT2 |
WNT3A Rabbit monoclonal antibody,clone OTIR4G6
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against CD9 (Center)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 115-145 amino acids from the Central region of human CD9. |
Rabbit Polyclonal Anti-SOX10 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SOX10 Antibody: synthetic peptide directed towards the middle region of human SOX10. Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT |