Antibodies

View as table Download

Rabbit Polyclonal KPNA2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KPNA2 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human KPNA2. The immunogen is located within amino acids 40 - 90 of KPNA2.

KPNA2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human KPNA2

Rabbit polyclonal antibody to karyopherin alpha 2 (karyopherin alpha 2 (RAG cohort 1, importin alpha 1))

Applications IF, WB
Reactivities Human (Predicted: Rat, Chimpanzee, Rhesus Monkey, Mouse)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 468 and 529 of KPNA2 (Uniprot ID#P52292)

KPNA2 Rabbit Polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human KPNA2

Rabbit Polyclonal Anti-KPNA2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KPNA2 antibody: synthetic peptide directed towards the middle region of human KPNA2. Synthetic peptide located within the following region: GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ