Antibodies

View as table Download

Rabbit Polyclonal Anti-ARC Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ARC
TA349251 is a possible alternative to TA349500.

KIR2DL3 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human KIR2DL3

Rabbit Polyclonal Anti-KIR2DL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIR2DL3 antibody is: synthetic peptide directed towards the middle region of Human KIR2DL3. Synthetic peptide located within the following region: GTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDP