Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Eotaxin Antibody
| Applications | ELISA, ICC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Eotaxin antibody was raised in rabbits against a peptide corresponding to amino acids near the carboxy terminus of human eotaxin. |
Rabbit polyclonal antibody to HLA-DMA (major histocompatibility complex, class II, DM alpha)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 52 and 245 of HLA-DMA |
HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRA |
Rabbit Polyclonal Anti-CD40LG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Rabbit polyclonal anti-HLA-DOA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HLA-DOA. |
Rabbit polyclonal anti-HLA-DOB antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HLA-DOB. |
Rabbit polyclonal anti-HA2Q antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HA2Q. |
Rabbit polyclonal anti-IL-13 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed recombinant mouse IL-13 |
Rabbit anti-HLA-DPB1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DPB1 |
Rabbit Polyclonal Anti-FCER1G Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FCER1G antibody: synthetic peptide directed towards the N terminal of human FCER1G. Synthetic peptide located within the following region: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQV |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Asthma