Rabbit anti-HPSE Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HPSE |
Rabbit anti-HPSE Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HPSE |
Anti-HPSE Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a C terminal 250 amino acids of human heparanase |
Rabbit Polyclonal Anti-HPSE Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HPSE antibody: synthetic peptide directed towards the N terminal of human HPSE. Synthetic peptide located within the following region: DPRFLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKESTFEERSY |
Rabbit Polyclonal Anti-HPSE Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HPSE antibody: synthetic peptide directed towards the N terminal of human HPSE. Synthetic peptide located within the following region: KLRLEWPYQEQLLLREHYQKKFKNSTYSRSSVDVLYTFANCSGLDLIFGL |