Antibodies

View as table Download

Rabbit polyclonal anti-SENP5 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human SENP5.

Rabbit polyclonal Anti-SENP5 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SENP5 antibody: synthetic peptide directed towards the middle region of human SENP5. Synthetic peptide located within the following region: LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR

Rabbit Polyclonal Anti-SENP5 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SENP5

Rabbit Polyclonal Anti-SENP5 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SENP5 Antibody: A synthesized peptide derived from human SENP5