Antibodies

View as table Download

Rabbit Polyclonal PARL Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PARL antibody was raised against a 15 amino acid peptide from near the amino terminus of human PARL.

Rabbit Polyclonal Anti-PARL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PARL Antibody: synthetic peptide directed towards the N terminal of human PARL. Synthetic peptide located within the following region: SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ

PARL (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PARL antibody was raised against a 15 amino acid peptide from near the amino terminus of human PARL.