Rabbit Polyclonal PARL Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PARL antibody was raised against a 15 amino acid peptide from near the amino terminus of human PARL. |
Rabbit Polyclonal PARL Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PARL antibody was raised against a 15 amino acid peptide from near the amino terminus of human PARL. |
Rabbit Polyclonal Anti-PARL Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PARL Antibody: synthetic peptide directed towards the N terminal of human PARL. Synthetic peptide located within the following region: SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ |
PARL (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PARL antibody was raised against a 15 amino acid peptide from near the amino terminus of human PARL. |