Antibodies

Jump to Filters
View as table Download
Fibroblast activation protein, alpha (FAP) Rabbit Polyclonal Antibody
TA347770

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-FAP-1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-FAP-1 Antibody: A synthesized peptide derived from human FAP-1
Fibroblast activation protein, alpha (FAP) Rabbit Polyclonal Antibody
TA339416

USD 539.00

5 Days

Rabbit Polyclonal Anti-FAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAP antibody is: synthetic peptide directed towards the C-terminal region of Human FAP. Synthetic peptide located within the following region: SWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTA