Rabbit Polyclonal Anti-FAP Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FAP |
Rabbit Polyclonal Anti-FAP Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FAP |
Rabbit Polyclonal Anti-FAP-1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FAP-1 Antibody: A synthesized peptide derived from human FAP-1 |
Rabbit Polyclonal Anti-FAP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FAP antibody is: synthetic peptide directed towards the C-terminal region of Human FAP. Synthetic peptide located within the following region: SWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTA |