Rabbit Polyclonal Anti-ABHD17A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM108A1 Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM108A1. Synthetic peptide located within the following region: VPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKI |
Rabbit Polyclonal antibody to NPEPPS (aminopeptidase puromycin sensitive)
| Applications | IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 328 and 648 of NPEPPS (Uniprot ID#P55786) |
Rabbit polyclonal UCHL1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Rat (Predicted: Mouse, Bovine, Pig, Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This UCHL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-214 amino acids from the C-terminal region of human UCHL1. |
Rabbit polyclonal CD71 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD71 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 649-677 amino acids from the C-terminal region of human CD71. |
Rabbit Polyclonal Anti-CPE Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPE antibody: synthetic peptide directed towards the N terminal of human CPE. Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG |
Anti-PSMD14 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 216-310 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 |
Germany
Japan
United Kingdom
China
