Antibodies

Jump to Filters
View as table Download
GJC1 Rabbit Polyclonal Antibody
TA351094

USD 380.00

In Stock

Rabbit Polyclonal Anti-GJC1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GJC1
GJC1 Rabbit Polyclonal Antibody
TA341666

USD 539.00

5 Days

Rabbit Polyclonal Anti-GJC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GJC1 antibody: synthetic peptide directed towards the middle region of human GJC1. Synthetic peptide located within the following region: ERLDLAVQAYSHQNNPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSVWI