Antibodies

Jump to Filters
View as table Download
MAP4K1 Rabbit Polyclonal Antibody
TA326238

USD 380.00

In Stock

Rabbit polyclonal MEKKK 1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MEKKK 1.
MAP4K1 Rabbit Polyclonal Antibody
TA338986

USD 539.00

5 Days

Rabbit Polyclonal Anti-MAP4K1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP4K1 antibody: synthetic peptide directed towards the N terminal of human MAP4K1. Synthetic peptide located within the following region: VHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATK