Antibodies

Jump to Filters
View as table Download
OR2B11 (C-term) Rabbit Polyclonal Antibody
AP53028PU-N

USD 580.00

2 Weeks

OR2B11 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 255-284 amino acids from the C-terminal region of Human OR2B11
OR2B11 Rabbit Polyclonal Antibody
TA337489

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR2B11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2B11 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2B11. Synthetic peptide located within the following region: LLSYGFIARAVLRIQSSKGRHKAFGTCSSHLMIVSLFYLPAIYMYLQPPS