ABCC4 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
ABCC4 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal ABCA1 Antibody
Applications | Block/Neutralize, ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Hamster |
Conjugation | Unconjugated |
Immunogen | Partial peptide sequence (peptide used resides somewhere between a.a 1100-1300) of the human ABCA1 gene. Actual immunogen sequence is proprietary information. |
Rabbit Polyclonal anti-CFTR Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CFTR |
Anti-ABCB6 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 590-824 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 6 |
Anti-ABCB6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 590-824 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 6 |
Anti-ABCB5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 563-812 amino acids of Human ATP-binding cassette sub-family B member 5 |
Rabbit Polyclonal ABCG1 Antibody
Applications | FC, IHC, Immunoblotting, IP, WB |
Reactivities | Human, Mouse, Rat, Hamster |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of human ABCG1 (between residues 300-400). [UniProt# P45844] |
Rabbit polyclonal antibody to ABCD2 (ATP-binding cassette, sub-family D (ALD), member 2)
Applications | WB |
Reactivities | Human (Predicted: Mouse, Chicken, Rat) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 338 and 588 of ABCD2 (Uniprot ID#Q9UBJ2) |
ABCD1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 257-285 amino acids from the Central region of human ABCD1. |
Rabbit Polyclonal Anti-ABCC9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ABCC9 |
Rabbit Polyclonal Anti-CFTR Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CFTR antibody was raised against an 18 amino acid peptide near the carboxy terminus of human CFTR. |
Rabbit Polyclonal ABCB5 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human ABCB5 protein (between residues 450-500) [UniProt Q2M3G0] |
TAP2 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TAP2 |
Rabbit Polyclonal Anti-Abca7 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abca7 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL |
Rabbit Polyclonal Anti-ABCG2(CD338) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ABCG2(CD338) Antibody: Peptide sequence around aa.160~164( R-I-N-R-V) derived from Human ABCG2(CD338). |