Antibodies

Jump to Filters
View as table Download
AGXT Rabbit Polyclonal Antibody
TA890098S

USD 188.00

2 Days

Rabbit Polyclonal anti-AGXT Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human AGXT
CAD Rabbit Polyclonal Antibody
TA890104S

USD 188.00

2 Days

Rabbit Polyclonal anti-CAD Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CAD
GAD67 (GAD1) Rabbit Polyclonal Antibody
TA327449

USD 365.00

3 Weeks

Rabbit anti-GAD1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human GAD1
Aspartate Aminotransferase (GOT1) Rabbit Polyclonal Antibody
TA332939

USD 365.00

3 Weeks

Rabbit anti-GOT1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GOT1
Alanine Transaminase (GPT) Rabbit Polyclonal Antibody
TA324938

USD 580.00

5 Days

Rabbit polyclonal GPT Antibody (N-term R133)

Applications WB
Reactivities Human, Mouse, Rat (Predicted: Bovine)
Conjugation Unconjugated
Immunogen This GPT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 118-144 amino acids from the N-terminal region of human GPT.
ALDH4A1 Rabbit Polyclonal Antibody
TA337809

USD 539.00

5 Days

Rabbit Polyclonal Anti-Aldh4a1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Aldh4a1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GSGLRWKHASSLKVANEPILAFTQGSPERDALQKALNDLKDQTEAIPCVV
Asparagine synthetase (ASNS) Rabbit Polyclonal Antibody
TA342876

USD 539.00

5 Days

Rabbit Polyclonal Anti-ASNS Antibody

Applications WB
Reactivities Rat, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ASNS antibody: synthetic peptide directed towards the C terminal of human ASNS. Synthetic peptide located within the following region: SVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADR
GAD67 (GAD1) Rabbit Polyclonal Antibody
TA347384

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-GAD1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GAD1 Antibody: A synthesized peptide derived from human GAD1
GAD67 (GAD1) (+ GAD2 / GAD65) Rabbit Polyclonal Antibody
SP1218P

USD 1,040.00

5 Days

GAD67 (GAD1) (+ GAD2 / GAD65) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Feline, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide sequence from the C-terminus of GAD