Rabbit anti-FTH1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FTH1 |
Rabbit anti-FTH1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FTH1 |
Rabbit Polyclonal Anti-FTMT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FTMT antibody is: synthetic peptide directed towards the middle region of Human FTMT. Synthetic peptide located within the following region: AYYFSRDDVALNNFSRYFLHQSREETEHAEKLMRLQNQRGGRIRLQDIKK |
Ceruloplasmin (CP) rabbit polyclonal antibody, Azide Free
Applications | ELISA, ID, IF, IHC, IP, R, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Ceruloplasmin isolated and purified from Human serum. Freund's complete adjuvant is used in the first step of the immunization procedure. |
HCCS (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 179~209 amino acids from the Central region of human HCCS / CCHL |
Rabbit Polyclonal Anti-GUSB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GUSB antibody: synthetic peptide directed towards the C terminal of human GUSB. Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF |
Rabbit Polyclonal Anti-COX15 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COX15 antibody: synthetic peptide directed towards the N terminal of human COX15. Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY |
Rabbit Polyclonal Anti-FECH Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FECH antibody: synthetic peptide directed towards the N terminal of human FECH. Synthetic peptide located within the following region: QHAQGAKPQVQPQKRYESNIRKPKTGILMLNMGGPETLGDVHDFLLRLFL |
COX10 Antibody - middle region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human COX10 |
Rabbit Polyclonal antibody to ALAS-E (aminolevulinate, delta-, synthase 2)
Applications | WB |
Reactivities | Human, Mouse (Predicted: Rat, Xenopus, Zebrafish, Bovine, X. tropicalis) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 211 and 587 of ALAS-E (Uniprot ID#P22557) |
beta glucuronidase (GUSB) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 514-544 amino acids from the C-terminal region of Human Beta-glucuronidase |
Heme Oxygenase 1 (HMOX1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 184-212 amino acids from the Central region of Human Heme oxygenase 1 / HMOX1 |
Rabbit polyclonal Anti-UGT1A7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A7 antibody: synthetic peptide directed towards the N terminal of human UGT1A7. Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN |
Rabbit Polyclonal Anti-FECH Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FECH antibody: synthetic peptide directed towards the N terminal of human FECH. Synthetic peptide located within the following region: LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGM |
Rabbit Polyclonal Anti-FECH Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FECH antibody: synthetic peptide directed towards the middle region of human FECH. Synthetic peptide located within the following region: KRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVW |
Rabbit Polyclonal Anti-UROD Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UROD antibody: synthetic peptide directed towards the N terminal of human UROD. Synthetic peptide located within the following region: SLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQV |