Rabbit Polyclonal Anti-TAS1R1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAS1R1 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS1R1. Synthetic peptide located within the following region: NINETKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGT |
Rabbit Polyclonal Anti-TAS1R1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAS1R1 antibody is: synthetic peptide directed towards the middle region of Human TAS1R1. Synthetic peptide located within the following region: QKRAVPGLKAFEEAYARADKKAPRPCHKGSWCSSNQLCRECQAFMAHTMP |
Germany
Japan
United Kingdom
China