Antibodies

View as table Download

Rabbit Polyclonal antibody to Triosephosphate isomerase (triosephosphate isomerase 1)

Applications IF, IHC, WB
Reactivities Human (Predicted: Yeast, Dog, Chicken, Chimpanzee, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 187 and 249 of Triosephosphate isomerase (Uniprot ID#P60174)

Rabbit Polyclonal Anti-TPI1 Antibody

Applications WB
Reactivities Human, Drosophila
Conjugation Unconjugated
Immunogen The immunogen for anti-TPI1 antibody: synthetic peptide directed towards the N terminal of human TPI1. Synthetic peptide located within the following region: MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID

Rabbit anti-TPI1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TPI1