Antibodies

View as table Download

Rabbit Polyclonal Anti-CAV3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CAV3

Rabbit Polyclonal Anti-CAV3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAV3 antibody: synthetic peptide directed towards the N terminal of human CAV3. Synthetic peptide located within the following region: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVG