Antibodies

Jump to Filters
View as table Download
PDHA1 Rabbit Polyclonal Antibody
TA346532

USD 485.00

5 Days

Rabbit Polyclonal Anti-PDHA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDHA1 antibody: synthetic peptide directed towards the C terminal of human PDHA1.
PDHB Rabbit Polyclonal Antibody
TA346540

USD 539.00

5 Days

Rabbit Polyclonal Anti-PDHB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDHB antibody: synthetic peptide directed towards the N terminal of human PDHB. Synthetic peptide located within the following region: GLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAID
GAD67 (GAD1) Rabbit Polyclonal Antibody
TA347384

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-GAD1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GAD1 Antibody: A synthesized peptide derived from human GAD1
GAD67 (GAD1) Rabbit Polyclonal Antibody
TA347753

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-GAD1/2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GAD1/2 Antibody: A synthesized peptide derived from human GAD1/2