Rabbit polyclonal PLCB2 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PLCB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 174-202 amino acids from the N-terminal region of human PLCB2. |
Rabbit Polyclonal Anti-INPP5K Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF |
Rabbit Polyclonal Anti-IPMK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IPMK antibody is: synthetic peptide directed towards the middle region of Human IPMK. Synthetic peptide located within the following region: SDSYETENQHYGRSLTKETIKDGVSRFFHNGYCLRKDAVAASIQKIEKIL |
Rabbit Polyclonal antibody to INPP5B (inositol polyphosphate-5-phosphatase, 75kDa)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 699 and 949 of INPP5B (Uniprot ID#P32019) |
USD 380.00
In Stock
Rabbit Polyclonal Anti-ISYNA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ISYNA1 Antibody: synthetic peptide directed towards the N terminal of human ISYNA1. Synthetic peptide located within the following region: LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD |
Rabbit Polyclonal Anti-PI4KB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PI4KB antibody: synthetic peptide directed towards the N terminal of human PI4KB. Synthetic peptide located within the following region: LILSDELKPAHRKRELPSLSPAPDTGLSPSKRTHQRSKSDATASISLSSN |
Rabbit Polyclonal Anti-PIP5K1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PIP5K1B antibody is: synthetic peptide directed towards the C-terminal region of Human PIP5K1B. Synthetic peptide located within the following region: VFKKIQALKASPSKKRCNSIAALKATSQEIVSSISQEWKDEKRDLLTEGQ |
Rabbit polyclonal antibody to MIPP (multiple inositol polyphosphate histidine phosphatase, 1)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 246 and 487 of MIPP (Uniprot ID#Q9UNW1) |
Rabbit anti-PTEN (Phospho-Ser380/Thr382/Thr383) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanPTEN around the phosphorylation site of serine 380 and threonine 382/383(R-Y-SP-D-TP-TP-D-S). |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China
