Antibodies

View as table Download

Rabbit Polyclonal HDAC1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human HDAC1.

Rabbit Polyclonal HDAC2 (Ser394) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human HDAC2 around the phosphorylation site of Sersine 394.
Modifications Phospho-specific

Rabbit Polyclonal NMDAR1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NMDAR1

Phospho-GRIN1-S896 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S896 of human GRIN1
Modifications Phospho-specific

Rabbit polyclonal Anti-Ndufs1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ndufs1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Ndufs1. Synthetic peptide located within the following region: VVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGEC

Rabbit Polyclonal Anti-CLTA Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Clta antibody is: synthetic peptide directed towards the C-terminal region of Rat Clta. Synthetic peptide located within the following region: EQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS

Rabbit Polyclonal Anti-Bax Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Bax Antibody: A synthesized peptide derived from human Bax

Rabbit Polyclonal Anti-p50 Dynamitin Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p50 Dynamitin Antibody: A synthesized peptide derived from human p50 Dynamitin

Rabbit Polyclonal Anti-COX42 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COX42 Antibody: A synthesized peptide derived from human COX42

Rabbit Polyclonal Anti-COX6C Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COX6C Antibody: A synthesized peptide derived from human COX6C

Rabbit Polyclonal Anti-CBP Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CBP Antibody: A synthesized peptide derived from human CBP

Rabbit Polyclonal Anti-p53 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53

Rabbit Polyclonal Anti-p53 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53

Rabbit Polyclonal Anti-sod2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-sod2 Antibody: A synthesized peptide derived from human sod2

Rabbit Polyclonal Anti-SOD1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SOD1 Antibody: Synthetic peptide from SOD1