Antibodies

Jump to Filters
View as table Download
TNF alpha (TNF) Rabbit Polyclonal Antibody
AP20373PU-N

USD 465.00

3 Weeks

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA336738

USD 605.00

5 Days

Rabbit Polyclonal TNF-alpha Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]
NMDAR2B (GRIN2B) Rabbit Polyclonal Antibody
TA309191

USD 545.00

2 Weeks

Rabbit Anti-NMDA NR2B Subunit Antibody

Applications WB
Reactivities Rat, Mouse, Human
Conjugation Unconjugated
Immunogen Fusion protein from the C-terminal region of the NR2B subunit
NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody
TA890121

USD 407.00

In Stock

Rabbit Polyclonal anti-GRIN2A Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIN2A
CD40L (CD40LG) (N-term) Rabbit Polyclonal Antibody
AP23309PU-N

USD 560.00

2 Weeks

CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L
CD32A (FCGR2A) Rabbit Polyclonal Antibody
TA327039

USD 365.00

In Stock

FCGR2A Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FCGR2A
NMDAR2B (GRIN2B) Rabbit Polyclonal Antibody
TA313306

USD 380.00

In Stock

Rabbit polyclonal GRIN2B(Ab-1303) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human GRIN2B around the phosphorylation site of serine 1303 (Q-H-SP-Y-D).
CD64 (FCGR1A) Rabbit Polyclonal Antibody
TA326989

USD 365.00

2 Weeks

Rabbit anti-FCGR1A Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FCGR1A
HLA-DRA Rabbit Polyclonal Antibody
TA327089

USD 365.00

3 Weeks

HLA-DRA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HLA-DRA
NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody
TA338510

USD 539.00

5 Days

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST
NMDAR2B (GRIN2B) Rabbit Polyclonal Antibody
AP20498PU-N

USD 445.00

3 Weeks

NMDAR2B (GRIN2B) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to the C-terminus of Human NMDAε2
NMDAR2B (GRIN2B) (N-term) Rabbit Polyclonal Antibody
AP23268PU-N

USD 560.00

2 Weeks

NMDAR2B (GRIN2B) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide mapping at the N-terminus of NMDAR2B of human origin
NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody
TA890121S

USD 188.00

2 Days

Rabbit Polyclonal anti-GRIN2A Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIN2A
NMDAR2B (GRIN2B) Rabbit Polyclonal Antibody
TA323551

USD 380.00

In Stock

Anti-GRIN2B Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1413-1425 amino acids of Human glutamate receptor, ionotropic, N-methyl D-aspartate 2B
NMDAR2B (GRIN2B) Rabbit Polyclonal Antibody
TA325996

USD 380.00

In Stock

Rabbit Polyclonal NMDAR2B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NMDAR2B