Antibodies

Jump to Filters
View as table Download
OR10H5 (C-term) Rabbit Polyclonal Antibody
AP53009PU-N

USD 580.00

2 Weeks

OR10H5 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 244-273 amino acids from the C-terminal region of human OR10H5
OR10H5 Rabbit Polyclonal Antibody
TA332322

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR10H5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR10H5 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10H5. Synthetic peptide located within the following region: NKAFSTCASHLTVVVVHYGFASVIYLKPKGPQSPEGDTLMGITYTVLTPF