Antibodies

Jump to Filters
View as table Download
TNF alpha (TNF) Rabbit Polyclonal Antibody
AP20373PU-N

USD 465.00

3 Weeks

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.
RANTES (CCL5) Rabbit Polyclonal Antibody
AP20618PU-N

USD 445.00

3 Weeks

RANTES (CCL5) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 50-100 of Human RANTES.
IL8 (CXCL8) Rabbit Polyclonal Antibody
TA325052

USD 580.00

2 Weeks

Rabbit polyclonal IL8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8.
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA336738

USD 605.00

5 Days

Rabbit Polyclonal TNF-alpha Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]
Eotaxin (CCL11) Rabbit Polyclonal Antibody
TA305947

USD 570.00

5 Days

Rabbit Polyclonal Eotaxin Antibody

Applications ELISA, ICC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Eotaxin antibody was raised in rabbits against a peptide corresponding to amino acids near the carboxy terminus of human eotaxin.
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA319289

USD 1,795.00

5 Days

Rabbit polyclonal TNF Alpha antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA319290

USD 1,795.00

5 Days

Rabbit polyclonal TNF alpha antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.
IL8 (CXCL8) Rabbit Polyclonal Antibody
AP20603PU-N

USD 465.00

3 Weeks

IL8 (CXCL8) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
RANTES (CCL5) Rabbit Polyclonal Antibody
TA332802

USD 365.00

3 Weeks

Rabbit anti-CCL5 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CCL5
RANTES (CCL5) Rabbit Polyclonal Antibody
TA342306

USD 485.00

5 Days

Rabbit Polyclonal Anti-CCL5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN
IL8 (CXCL8) Rabbit Polyclonal Antibody
TA347890

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Interleukin 8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 8 Antibody: A synthesized peptide derived from human Interleukin 8