Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal CD38 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
Rabbit Polyclonal Anti-SRD5A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
DLL4 rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to the internal region of human DLL4. |
Rabbit Polyclonal antibody to IL1 receptor 2 (interleukin 1 receptor, type II)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 172 and 398 of IL1 Receptor 2 (Uniprot ID#P27930) |
Rabbit Polyclonal Anti-HSD3B1 Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD3B1 antibody: synthetic peptide directed towards the N terminal of human HSD3B1. Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ |
Rabbit Polyclonal Anti-HSD3B2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD3B2 antibody: synthetic peptide directed towards the N terminal of human HSD3B2. Synthetic peptide located within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN |
Rabbit polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Monkey, Pig, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 654 and 944 of alpha Glucosidase II (Uniprot ID#Q14697) |
Rabbit Polyclonal antibody to NAT2 (N-acetyltransferase 2 (arylamine N-acetyltransferase))
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 198 of NAT2 (Uniprot ID#P11245) |
Rabbit polyclonal anti-ABCB1 antibody
| Applications | WB |
| Reactivities | Human, Monkey, Dog, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 262-277 of human ABCB1 protein. |
Rabbit Polyclonal Antibody against APP
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat, Pig, Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This APP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 736-770 amino acids from the C-terminal region of human APP. |
Active filters
Reactivities
- Monkey
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Transmembrane
Filter by
Category
Target Symbol
Conjugates
Assay Types
Pathways
- Hematopoietic cell lineage (5)
- Metabolic pathways (5)
- Androgen and estrogen metabolism (4)
- C21-Steroid hormone metabolism (2)
- Parkinson's disease (2)
- Prostate cancer (2)
- ABC transporters (1)
- Adipocytokine signaling pathway (1)
- Alzheimer's disease (1)
- Caffeine metabolism (1)
- Calcium signaling pathway (1)
- Cell adhesion molecules (CAMs) (1)
- Cytokine-cytokine receptor interaction (1)
- Drug metabolism - other enzymes (1)
- ECM-receptor interaction (1)
- MAPK signaling pathway (1)
- N-Glycan biosynthesis (1)
- Natural killer cell mediated cytotoxicity (1)
- Nicotinate and nicotinamide metabolism (1)
- Notch signaling pathway (1)
- PPAR signaling pathway (1)
- Toll-like receptor signaling pathway (1)