Rabbit Polyclonal Anti-ITGB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ITGB1 |
Rabbit Polyclonal Anti-ITGB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ITGB1 |
Rabbit polyclonal anti-EPHB6 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EPHB6. |
Rabbit Polyclonal Anti-SEMA6D Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SEMA6D |
Rabbit Polyclonal CXCR4-Lo Antibody
Applications | ELISA, ICC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CXCR4-Lo antibody was raised against a peptide corresponding to nine amino acids near the amino terminus of human CXCR4 isoform a. |
Rabbit polyclonal c-Met (Tyr1003) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human c-Met around the phosphorylation site of tyrosine 1003 (V-D-YP-R-A). |
Modifications | Phospho-specific |
Rabbit polyclonal EPHA2/3/4 (Ab-588/596) antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EPHA2/3/4 around the phosphorylation site of tyrosine 588/596 (T-YP-V-D-P). |
Rabbit polyclonal anti-Neuropilin-1 antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 816 of mouse Neuropilin 1 |
Rabbit polyclonal EFNB2 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This EFNB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 157-186 amino acids from the Central region of human EFNB2. |
Rabbit Polyclonal Anti-SEMA6D Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SEMA6D antibody: synthetic peptide directed towards the N terminal of human SEMA6D. Synthetic peptide located within the following region: VSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLY |
Rabbit Polyclonal Anti-SEMA4F Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SEMA4F antibody: synthetic peptide directed towards the n terminal of human SEMA4F. Synthetic peptide located within the following region: PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL |
Rabbit polyclonal anti-Ephrin-B3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Ephrin-B3. |
Rabbit polyclonal c-Met (Ab-1003) antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human c-Met around the phosphorylation site of tyrosine 1003 (V-D-YP-R-A). |
Modifications | Phospho-specific |
Rabbit polyclonal Ephrin B1/B2/B3 (Tyr324) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Ephrin B1/B2/B3 around the phosphorylation site of tyrosine 324 (G-D-YP-G-H). |
Modifications | Phospho-specific |
Rabbit polyclonal EPHA2/3/4 (Tyr588/596) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EPHA2/3/4 around the phosphorylation site of tyrosine 588/596 (T-YP-V-D-P). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-EPHA1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EPHA1. |