Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-HCLS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HCLS1 antibody: synthetic peptide directed towards the N terminal of human HCLS1. Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP |
Rabbit Polyclonal Anti-HCLS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HCLS1 antibody: synthetic peptide directed towards the N terminal of human HCLS1. Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP |
Anti-PARD6A Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 334-346 amino acids of human par-6 partitioning defective 6 homolog alpha (C. elegans) |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal beta Catenin antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mouse, Bovine, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus. |
Active filters
Reactivities
- Mouse
Applications
- WB
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Families
- Transcription Factors
Pathways
- Tight junction