Rabbit Polyclonal HIF-2 alpha Antibody
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, SDS-PAGE, Simple Western, WB |
| Reactivities | Fish, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein. |
Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | ChIP, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Goat, Hamster, Rabbit, Primate |
| Conjugation | Unconjugated |
| Immunogen | A fusion protein including residues 530-825 of the mouse HIF-1 alpha protein. [UniProt# Q61221] |
Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | ChIP, ELISA, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665] |
Rabbit Polyclonal Anti-HIF1A Antibody
| Applications | WB |
| Reactivities | Human, Chicken, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIF1A antibody: synthetic peptide directed towards the middle region of human HIF1A. Synthetic peptide located within the following region: VKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNA |
Rabbit polyclonal JUN Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This JUN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 222-251 amino acids from the C-terminal region of human JUN. |
Rabbit polyclonal c-Jun (Ab-170) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human c-Jun around the phosphorylation site of Tyrosine 170. |
HIF-1 alpha (HIF1A) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide mapping at the N-terminus of HIF-1α of Human origin, different from the related Rat and Mouse sequences by two sequences. |
Rabbit polyclonal Phospho-cJun(S63) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun. |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China
